PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02082.1.p
Common NameEUGRSUZ_A02082, LOC104442716
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 378aa    MW: 41747.6 Da    PI: 7.3337
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14e-3346100155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprl+Wt++LH+rFveav+qLGG++kAtPk+il++m+++gLtl+h+kSHLQkYRl
  Eucgr.A02082.1.p  46 KPRLKWTTDLHKRFVEAVNQLGGADKATPKSILKAMGIPGLTLYHLKSHLQKYRL 100
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.43643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-3144101IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-2446101IPR006447Myb domain, plants
PfamPF002499.2E-104899IPR001005SANT/Myb domain
PfamPF143791.5E-20143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MHNHSLYGGK NFHPSSRMSI LSERHLLLQA ANGPGDSGLI LSTDAKPRLK WTTDLHKRFV  60
EAVNQLGGAD KATPKSILKA MGIPGLTLYH LKSHLQKYRL SKNLHGQATN GTNRAVAEVK  120
VSEANGPHLN NSSIGIQVNK NLHISEAFQV QIEVQRRLHE QMEAQRHMQL HIEAQGKYLQ  180
AVLEKAQETL GRHDSGSVGL EAAKYQLSEL VSKVSADSLS STFPDVVDIH LHQMQMNQNT  240
DGSLDSCLTC ERPQKDREED VDGSRSRDHH PNPFLLPSDI ADDRRRGQTV PEDAEERVKR  300
AICDLSTTCG YRSSSEGTNG RVDEKIKLAS PRRTSDDETG SIEAGREGLS LGYGSSRLRS  360
KLDLNVRDED LNGFGWS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02082.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054431.10.0PREDICTED: myb family transcription factor APL isoform X2
TrEMBLA0A059DGG50.0A0A059DGG5_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s04820.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-106G2-like family protein